- Recombinant Shewanella baltica UPF0391 membrane protein Sbal195_1447 (Sbal195_1447)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1128445
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 6,060 Da
- E Coli or Yeast
- 21186
- UPF0391 membrane protein Sbal195_1447 (Sbal195_1447)
Sequence
MLGWTLVFLVVAVIAGLLGFTGIAGAAAGIAKIIFFVFIVLLVISLLVNAFRGKSPRL